DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:221 Identity:70/221 - (31%)
Similarity:108/221 - (48%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 PNNYNNYGNNNTQDLFQTPSTASYNHNE--KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHY 487
            |.|..||..::      .|:.:|....:  :|.|||..||..||..:||.::||||||.||:|.:
 Frog     8 PYNCFNYDGDD------YPACSSDEEKKFNRPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKKF 66

  Fly   488 PYYRKETNKGWQNSIRHNLSLNRYFIKVARSQ-DEPGKGSFWRIDPDSGAK-LID----HSYKKR 546
            |||| ...:.||||||||||||..|:||.|:: :|.|||::|..  .||.: ::|    .:||:|
 Frog    67 PYYR-SNQRAWQNSIRHNLSLNSCFVKVPRTEGNEKGKGNYWSF--ASGCESMLDLFENGNYKRR 128

  Fly   547 RQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQN 611
            |:|.:.                ......|:.:..|.:       .|| .....::...:||.::.
 Frog   129 RRRRNM----------------KKCQKDRKQNQAQAL-------HPG-EFSTSSSTAHVIYGNEK 169

  Fly   612 AHQQQQQQQQQQQQQTLSNNSNQYSS 637
            ..:...:|.:......:||..:|.||
 Frog   170 RTESTSRQMETDSLYPISNRQSQTSS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/88 (52%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 46/88 (52%)
COG5025 33..>224 CDD:227358 64/190 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.