DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxg1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:357 Identity:103/357 - (28%)
Similarity:160/357 - (44%) Gaps:58/357 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 LQQQQH--PHHPPAHHLPLQQQQQQQQPAHHPLPHTPHHPLHHTALHQQQQRSGSIVVAPPAGAA 371
            :|...|  |||...|||.|.||....||             ||..|.::.:...|::        
 Frog    25 VQNDNHPQPHHHHHHHLQLPQQSHHLQP-------------HHRPLQEEDELDKSLL-------- 68

  Fly   372 AHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNT 436
                                  |.|:..|.|.....||:..|...::   :::....:..|..:.
 Frog    69 ----------------------EVKTESLPPGKGDPAASELPGEDKE---KSEDKKADGGGGKDG 108

  Fly   437 QDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNS 501
            ::..:.....:..: ||||:||..||:.||..:|:|:|||:|||.||:|::|||| |..:|||||
 Frog   109 ENGKEGGEKKNGKY-EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYR-ENKQGWQNS 171

  Fly   502 IRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPV 566
            ||||||||:.|:||.|..|:||||::|.:||.|....|..:..|.|:||:.. |......|.|.:
 Frog   172 IRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTS-RAKLAFKRGARL 235

  Fly   567 SPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYN-SQNAHQQQQQQQQQQQQQTLSN 630
            :.:.:.....:..|.      .|.||.:||....|...:.|| :.:|:............|....
 Frog   236 TSTGLTFMDRAGSLY------WPMSPFLSLHHPRASSALSYNGTTSAYPSHPMPYSSVLTQNSLG 294

  Fly   631 NSNQYSSGSPYYVTNQSSGVATPQTHVEGSAA 662
            :::.:|:.:...|....:|.....||...:||
 Frog   295 SNHSFSTSNGLSVDRLVNGEIPYATHHLTAAA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 51/86 (59%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 52/88 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.