DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxl1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_012817795.1 Gene:foxl1 / 100038263 XenbaseID:XB-GENE-5880620 Length:406 Species:Xenopus tropicalis


Alignment Length:333 Identity:90/333 - (27%)
Similarity:140/333 - (42%) Gaps:78/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVA 516
            :||||||..||..||..:||.::||:|||.||:..:|:|. :..:|||||||||||||..||||.
 Frog    50 QKPPYSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYH-DNKQGWQNSIRHNLSLNDCFIKVP 113

  Fly   517 RSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR-----SSQGFR-----PPYGMPRSA------- 564
            |.:..|||||:|.:||.......:.::::|:::     ..:|.|     ..|.:..:|       
 Frog   114 REKGRPGKGSYWTLDPKCLDMFENGNFRRRKRKPKPILCQEGKRHKAEAAEYRLADAACKGTTCK 178

  Fly   565 ------------------PVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQN 611
                              |.|....|::.|.|..:|      .|..|..::...| ||       
 Frog   179 VAGNTGQNGSQDAPLGRKPTSACEKDSAGEMSSSED------EGGSGDYIKTSPA-PE------- 229

  Fly   612 AHQQQQQQQQQQQQQTLSNNSNQYSSGSP-YYVT--------NQSSGVATPQTHVEGSAASGGGG 667
            .|.|::            .:...::|..| :||:        ..||.....|.|.:|:.....|.
 Frog   230 CHNQER------------TSGTYWNSLHPSFYVSVPLLSDQVTLSSKREGSQAHEQGNRLLACGA 282

  Fly   668 GGGVGALLALKRNHVMGGGASQHTLHQQQAVAQQQHSEIIYEELPTDYSGHIEASEEECVTTATD 732
            .|.:||......|.  ..||:.....:.:.::|:.......:.:    ....:.|..||...|..
 Frog   283 QGHLGAPSPGSNNE--KAGATDANCKEAEQLSQKSARSFSIDSI----LSRSDQSAPECGAPAPP 341

  Fly   733 ATVAKRPK 740
            | |:|.|:
 Frog   342 A-VSKVPE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
foxl1XP_012817795.1 Forkhead 50..136 CDD:365978 47/86 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.