DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxe1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:412 Identity:104/412 - (25%)
Similarity:167/412 - (40%) Gaps:98/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 TALHQQQQRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISIP-KKEQKSPYLSPTGTISAANSCP 413
            ||.:||     |...|..|||:....:|          :::| .|.:|.|  :|..::|...|  
 Frog     2 TAENQQ-----SPTRATAAGASLQQASG----------LTMPVVKVEKDP--APEASMSNGGS-- 47

  Fly   414 ASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSG 478
                :|  ::.|.     |....:.|          ...||||||..||..||:.:.|::|||.|
 Frog    48 ----EG--EDTPK-----GRRRKRPL----------QKGKPPYSYIALIAMAIANSTDRKLTLGG 91

  Fly   479 IYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSY 543
            ||.||.:.:|:|| :.:|.|||||||||:||..|||:.|....||||::|.:||::.......|:
 Frog    92 IYKFITERFPFYR-DNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDPNAEDMFDSGSF 155

  Fly   544 KKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYN 608
            .:||:|..:.....|         |:::.::...||||               ..||..|..:|.
 Frog   156 LRRRKRFKRTDLTTY---------PAYIHDTSMFSPLQ---------------VARATYPNTVYP 196

  Fly   609 SQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVT-------------NQSSGVATPQTHVEGS 660
            :........||..........::|..:||..|...:             .|.:...:|:.:...|
 Frog   197 NMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVFSINTLIGHSGSEHAQQPNRSISPEVNSTSS 261

  Fly   661 AASGGGGG-----GGVGALLALKRNHVMGGGASQHTLHQQQAVAQQQHSEIIYE----ELPT--- 713
            ::...||.     .|.|.:|....|.......:.| |...|:.....::::...    .:||   
 Frog   262 SSCNYGGSTYSSQAGSGTMLPRSTNPYSYSVPNSH-LQMNQSSYPHSNAQLFGSASRLPMPTSPP 325

  Fly   714 ------DYSGHIEASEEECVTT 729
                  |:.|.:...:...:||
 Frog   326 MNSDAVDFYGRMSPGQYTSLTT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 45/86 (52%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 45/88 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.