DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxd7

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:132 Identity:59/132 - (44%)
Similarity:81/132 - (61%) Gaps:4/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507
            ||::|.:.:.||||||..||..||..:|.|:||||.|..||...:.||| |....||||||||||
Zfish    54 PSSSSKSSSVKPPYSYIALITMAILQSPKKRLTLSEICDFISHRFVYYR-EKFPAWQNSIRHNLS 117

  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR-SSQGFRPPYGMPRSAPVSPSHM 571
            ||..|:|:.|....||||::|.:||:|.....:.|:.:||:| ..|.|:  :|:.:...:.||..
Zfish   118 LNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGSFLRRRKRFKRQHFK--FGVFKDQALQPSGF 180

  Fly   572 DN 573
            .|
Zfish   181 PN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 43/83 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.