DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxl2l

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001122282.1 Gene:foxl2l / 100004081 ZFINID:ZDB-GENE-081022-71 Length:260 Species:Danio rerio


Alignment Length:205 Identity:70/205 - (34%)
Similarity:94/205 - (45%) Gaps:53/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVA 516
            |||||||..||..||..:.||:|||:.|||:|:..:|||.| ..||||||||||||||..|:|:.
Zfish    34 EKPPYSYVALIAMAIRESEDKKLTLNDIYSYIISKFPYYEK-NKKGWQNSIRHNLSLNECFVKIP 97

  Fly   517 RSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRP---PYGMPRSAPVSPSHMDNSRESS 578
            |......||:||.:||.........:|::|| |..:.:||   |.|                   
Zfish    98 RESGGERKGNFWTLDPAFNDMFEKGNYRRRR-RVKRPYRPAALPSG------------------- 142

  Fly   579 PLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYV 643
                               ...|||..:          ||:....|...:|:.|..:.||||.::
Zfish   143 -------------------YNFADPYCL----------QQEPVYWQSPFVSSGSWSHHSGSPTHI 178

  Fly   644 TNQSSGVATP 653
            ::...|.|.|
Zfish   179 SSYMLGNARP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
foxl2lNP_001122282.1 Forkhead 35..121 CDD:278670 46/86 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.