DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and si:ch211-145o7.3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_001923743.3 Gene:si:ch211-145o7.3 / 100003583 ZFINID:ZDB-GENE-061207-6 Length:332 Species:Danio rerio


Alignment Length:322 Identity:92/322 - (28%)
Similarity:139/322 - (43%) Gaps:75/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 LPHTPHHPLHHTALHQQQQRSGSIVVAP----PAGA-AAHLIAGDGPGIYSP---LKIS-IPKKE 394
            ||  ||.|||.     .:..|.::.::|    ||.. ::||.:...|.:...   |.:| .|:::
Zfish     8 LP--PHSPLHF-----PRNNSEALPLSPSLPQPASLHSSHLHSSSSPRVSGGSHCLSLSTAPEQD 65

  Fly   395 QKS--PYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKPPYS 457
            ..:  .:|...|.:......|.      |...|..::..   ..|.|..:|:        |||||
Zfish    66 DLTCLNWLHQRGNLLPLQPLPK------ISTLPQMFDPI---PAQHLPSSPA--------KPPYS 113

  Fly   458 YAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEP 522
            ::.||..||..:|:|.|.:.|||.:||:::||| ||...||:||:||||||::.|.::.|.:.:.
Zfish   114 FSSLIFMAIEDSPEKSLPVKGIYEWIVENFPYY-KEAPGGWRNSVRHNLSLSKSFQRIHRDKSQS 177

  Fly   523 -GKGSFWRIDPDSGAKLID-----HSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSR----ES 577
             ||||.||:.|:....|::     | |..|..||.          .:.||.....||.:    |:
Zfish   178 VGKGSLWRVCPEYRPALLEVLRKTH-YCHRTNRSL----------LNKPVLLEATDNGQNMFNET 231

  Fly   578 SPLQDI-VLQSAP-----------------GSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQ 621
            ..|.|: .|.|.|                 |.|.::.|....||.........|..|.||.|
Zfish   232 MELSDLDSLSSNPPCSFTPDHEELIPMESVGLPEVTGEDTEKDPLADSGYIELHYYQYQQYQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 42/87 (48%)
si:ch211-145o7.3XP_001923743.3 Forkhead 109..196 CDD:278670 42/87 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.