DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and CSD1

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001077494.1 Gene:CSD1 / 837405 AraportID:AT1G08830 Length:152 Species:Arabidopsis thaliana


Alignment Length:151 Identity:92/151 - (60%)
Similarity:104/151 - (68%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VVKAVCVINGD--AKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFN 64
            :.|.|.|:|..  ..||:||.||..|. ..|||.|.||..||||||||..||.||||||:|||||
plant     1 MAKGVAVLNSSEGVTGTIFFTQEGDGV-TTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTGPHFN 64

  Fly    65 PYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGG 129
            |.||.||||.|.|||.||||||....|......|||.:|.|.|.:||:||.||||||.||||:||
plant    65 PDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHADPDDLGKGG 129

  Fly   130 HELSKSTGNAGARIGCGVIGI 150
            ||||.:|||||.|:.||:||:
plant   130 HELSLATGNAGGRVACGIIGL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 91/149 (61%)
CSD1NP_001077494.1 PLN02386 1..152 CDD:166027 92/151 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 181 1.000 Domainoid score I1031
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H392
Inparanoid 1 1.050 188 1.000 Inparanoid score I1397
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - otm2903
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.