DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and CSD3

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_197311.1 Gene:CSD3 / 831928 AraportID:AT5G18100 Length:164 Species:Arabidopsis thaliana


Alignment Length:150 Identity:85/150 - (56%)
Similarity:110/150 - (73%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKAVCVINGD--AKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNP 65
            ::||.:|.||  .:|.:.|.|:.||| ..|:|::.||:.|.||||:|.|||.||||:|:||||||
plant     8 LRAVALIAGDNNVRGCLQFVQDISGT-THVTGKISGLSPGFHGFHIHSFGDTTNGCISTGPHFNP 71

  Fly    66 YGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGH 130
            ..:.||.|.:|.||.||||||.|..:...::.|.|..|.|.|..||:||.||||||.||||:|||
plant    72 LNRVHGPPNEEERHAGDLGNILAGSNGVAEILIKDKHIPLSGQYSILGRAVVVHADPDDLGKGGH 136

  Fly   131 ELSKSTGNAGARIGCGVIGI 150
            :|||||||||:|:|||:||:
plant   137 KLSKSTGNAGSRVGCGIIGL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 84/148 (57%)
CSD3NP_197311.1 PLN02642 1..164 CDD:178248 85/149 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 181 1.000 Domainoid score I1031
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I1397
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - otm2903
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.