DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and sod3b

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_001332758.1 Gene:sod3b / 794006 ZFINID:ZDB-GENE-030131-8743 Length:192 Species:Danio rerio


Alignment Length:163 Identity:57/163 - (34%)
Similarity:82/163 - (50%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKAVCVINGDAK---------GTVFFEQESSGTPVKVSGEVCGL---AKGLHGFHVHEFGDNTNG 55
            ::|||.:..:.:         |.:.|.|......:.|:..:.||   ::.....|:||:||.:.|
Zfish    36 LQAVCRMQPNTRLEPGMPRVYGHILFRQSGPKEKLSVTFRLYGLPADSQQPRAMHIHEYGDLSRG 100

  Fly    56 CMSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNI---TDSKITLFGADSIIGRTVV 117
            |.|:|.|:||....|      .:|.||.||.     .|....|   .:|..||||..||:||:||
Zfish   101 CDSTGGHYNPLNVNH------PQHPGDFGNF-----VPVNKKIRQSLESPATLFGKLSIVGRSVV 154

  Fly   118 VHADADDLGQGGHELSKSTGNAGARIGCGVIGI 150
            :|...||||:||:..|...||||.|:.|.|||:
Zfish   155 IHEGKDDLGRGGNVGSLLNGNAGGRLACCVIGL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 56/161 (35%)
sod3bXP_001332758.1 Sod_Cu 55..185 CDD:278508 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.