DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and SOD3

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_003093.2 Gene:SOD3 / 6649 HGNCID:11181 Length:240 Species:Homo sapiens


Alignment Length:147 Identity:54/147 - (36%)
Similarity:69/147 - (46%) Gaps:34/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDEN 77
            ||...||..|...|....|.         ...|||:|||.:.||.|:|||:||....|      .
Human    91 AKLDAFFALEGFPTEPNSSS---------RAIHVHQFGDLSQGCESTGPHYNPLAVPH------P 140

  Fly    78 RHLGDLGNIEATGDCPTKVNITDSKI---------TLFGADSIIGRTVVVHADADDLGQGGHELS 133
            :|.||.||..          :.|..:         :|.|..||:||.|||||..||||:||::.|
Human   141 QHPGDFGNFA----------VRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQAS 195

  Fly   134 KSTGNAGARIGCGVIGI 150
            ...||||.|:.|.|:|:
Human   196 VENGNAGRRLACCVVGV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 53/145 (37%)
SOD3NP_003093.2 Sod_Cu 74..210 CDD:306566 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.