DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and sod1

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_571369.1 Gene:sod1 / 30553 ZFINID:ZDB-GENE-990415-258 Length:154 Species:Danio rerio


Alignment Length:154 Identity:91/154 - (59%)
Similarity:110/154 - (71%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVVKAVCVI--NGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHF 63
            ||.|||||:  .|:..|||:|.||....||||:||:.||..|.||||||.||||||||:|:||||
Zfish     1 MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHF 65

  Fly    64 NPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQG 128
            ||:.|.||.|.|..||:|||||:.|......|:.|.|:.:||.|..||||||:|:|...||||:|
Zfish    66 NPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKG 130

  Fly   129 GHELSKSTGNAGARIGCGVIGIAK 152
            |:|.|..|||||.|:.||||||.:
Zfish   131 GNEESLKTGNAGGRLACGVIGITQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 88/149 (59%)
sod1NP_571369.1 Cu-Zn_Superoxide_Dismutase 4..147 CDD:238186 83/142 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575173
Domainoid 1 1.000 181 1.000 Domainoid score I3434
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H392
Inparanoid 1 1.050 194 1.000 Inparanoid score I3822
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - oto39174
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1372
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1515.440

Return to query results.
Submit another query.