DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and Sod3

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_037012.1 Gene:Sod3 / 25352 RGDID:3733 Length:244 Species:Rattus norvegicus


Alignment Length:167 Identity:60/167 - (35%)
Similarity:79/167 - (47%) Gaps:38/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVCVINGDA---------KGTVFFEQESSGTPVKVSGEVCGLA----KGLHGFHVHEFGDNTNGC 56
            |||.:...|         .|.|.|.|....:.::.|..:.|..    ...|..|||||||.:.||
  Rat    68 AVCRVQPSAMLPPDQPQITGLVLFRQLGPSSRLEASFNLEGFPAEQNTSNHAIHVHEFGDLSQGC 132

  Fly    57 MSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKI---------TLFGADSII 112
            .|:|||:||.|..|      .:|.||.||..          :.|.::         :|.|..||:
  Rat   133 ESTGPHYNPLGVPH------PQHPGDFGNFV----------VRDGRLWKHRMGLATSLAGPHSIL 181

  Fly   113 GRTVVVHADADDLGQGGHELSKSTGNAGARIGCGVIG 149
            ||.|||||..||||:||::.|...||||.|:.|.|:|
  Rat   182 GRAVVVHAGEDDLGKGGNQASVQNGNAGRRLACCVVG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 60/167 (36%)
Sod3NP_037012.1 Sod_Cu 84..217 CDD:278508 54/148 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.