DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and sod-4

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001255002.1 Gene:sod-4 / 176336 WormBaseID:WBGene00004933 Length:221 Species:Caenorhabditis elegans


Alignment Length:138 Identity:75/138 - (54%)
Similarity:101/138 - (73%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRH 79
            ||:.|:|  ||:.:|::|.|.|||.|.||||:||.||..|||:|:|.|:||:...||||.|.|||
 Worm    42 GTIDFDQ--SGSFLKLNGSVSGLAAGKHGFHIHEKGDTGNGCLSAGGHYNPHKLSHGAPDDSNRH 104

  Fly    80 LGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHELSKSTGNAGARIG 144
            :|||||||:.....|.::::||..:|.|..|||||:||:|...||||:|..:.||:|||||:|:.
 Worm   105 IGDLGNIESPASGDTLISVSDSLASLSGQYSIIGRSVVIHEKTDDLGRGTSDQSKTTGNAGSRLA 169

  Fly   145 CGVIGIAK 152
            ||.|||.:
 Worm   170 CGTIGIVE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 73/134 (54%)
sod-4NP_001255002.1 Cu-Zn_Superoxide_Dismutase 41..170 CDD:238186 70/129 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.