DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and sod-1

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001021956.1 Gene:sod-1 / 174141 WormBaseID:WBGene00004930 Length:180 Species:Caenorhabditis elegans


Alignment Length:152 Identity:81/152 - (53%)
Similarity:110/152 - (72%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAVCVINGD-AKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYG 67
            :||.|:.|: ..||::..|:|......:.||:.||..||||||||::||:||||:|:||||||:|
 Worm    26 RAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFG 90

  Fly    68 KEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQG---G 129
            |.||.|..|.||:|||||:||..|...|:.:||:.:||:|.::::||::||||..||||:|   .
 Worm    91 KTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDK 155

  Fly   130 HELSKSTGNAGARIGCGVIGIA 151
            .|.||.|||||||..||||.:|
 Worm   156 AEESKKTGNAGARAACGVIALA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 80/149 (54%)
sod-1NP_001021956.1 Cu-Zn_Superoxide_Dismutase 26..171 CDD:238186 76/144 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2271
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H392
Inparanoid 1 1.050 177 1.000 Inparanoid score I2688
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - otm14353
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1372
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.960

Return to query results.
Submit another query.