DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and sod-5

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_494779.1 Gene:sod-5 / 173776 WormBaseID:WBGene00007036 Length:178 Species:Caenorhabditis elegans


Alignment Length:152 Identity:78/152 - (51%)
Similarity:104/152 - (68%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAVCVINGDAK-GTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYG 67
            :||.|:.|.|. |||:..|::.|...:..||:.||:.||||||:|::||:|:||.|:||||||..
 Worm    24 RAVAVLRGTAVFGTVWLTQKAEGEETEFEGEIKGLSPGLHGFHIHQYGDSTDGCTSAGPHFNPCK 88

  Fly    68 KEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQG---G 129
            ..||......||:|||||:||..|...|:..:|..::||||:::|||::|||.|.||||||   .
 Worm    89 MNHGGRDSVVRHVGDLGNVEAGADGVAKIKFSDKVVSLFGANTVIGRSMVVHVDRDDLGQGIDDK 153

  Fly   130 HELSKSTGNAGARIGCGVIGIA 151
            .|.|..|||||||..||||.:|
 Worm   154 AEESLKTGNAGARAACGVIALA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 77/149 (52%)
sod-5NP_494779.1 Sod_Cu 33..172 CDD:278508 71/138 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2271
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H392
Inparanoid 1 1.050 177 1.000 Inparanoid score I2688
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - otm14353
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1372
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.960

Return to query results.
Submit another query.