DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and Ccs

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_058588.1 Gene:Ccs / 12460 MGIID:1333783 Length:274 Species:Mus musculus


Alignment Length:146 Identity:66/146 - (45%)
Similarity:88/146 - (60%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVCVIN--GDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYG 67
            ||.::.  |..:|.|.|.|.||...: :.|.:.||..||||.|||::||.|..|.|.|.||||.|
Mouse    89 AVAILEGCGSIQGVVRFLQLSSELCL-IEGTIDGLEPGLHGLHVHQYGDLTRDCNSCGDHFNPDG 152

  Fly    68 KEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHEL 132
            ..||.|.|.:||.|||||:.|.........|.|.::.::   .:|||::|:....||||:|||.|
Mouse   153 ASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLKVW---DVIGRSLVIDEGEDDLGRGGHPL 214

  Fly   133 SKSTGNAGARIGCGVI 148
            ||.|||:|.|:.||:|
Mouse   215 SKITGNSGKRLACGII 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 66/146 (45%)
CcsNP_058588.1 PLN02957 13..253 CDD:215516 66/146 (45%)
HMA 15..73 CDD:238219
Superoxide dismutase-like 88..234 66/146 (45%)
Cu-Zn_Superoxide_Dismutase 89..227 CDD:238186 63/141 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D608177at33208
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.