DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and LOC110439923

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_021333354.1 Gene:LOC110439923 / 110439923 -ID:- Length:267 Species:Danio rerio


Alignment Length:146 Identity:69/146 - (47%)
Similarity:94/146 - (64%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVCVINGD--AKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYG 67
            ||.:::|.  .:|.|.|.|.|....: :.|.:.||:.|.||.||||.||.|..|.|.|.||||:.
Zfish    83 AVAMLSGAGLVQGVVRFLQLSQDRCL-IDGTIDGLSPGAHGLHVHELGDLTQDCRSCGDHFNPFR 146

  Fly    68 KEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHEL 132
            |:||||.|.:||:||||||.|..|......:.||:|.::   .:|||::||.:..||||:|.|.|
Zfish   147 KQHGAPQDSDRHVGDLGNISAGPDGRASFRLEDSQIKVW---DVIGRSLVVDSGEDDLGRGNHPL 208

  Fly   133 SKSTGNAGARIGCGVI 148
            ||:|||:|.|:.||:|
Zfish   209 SKTTGNSGERLACGII 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 69/146 (47%)
LOC110439923XP_021333354.1 Cu-Zn_Superoxide_Dismutase 9..247 CDD:321233 69/146 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D608177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.