DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32071 and CG6660

DIOPT Version :10

Sequence 1:NP_729667.1 Gene:CG32071 / 39246 FlyBaseID:FBgn0052071 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_651104.1 Gene:CG6660 / 42708 FlyBaseID:FBgn0039030 Length:272 Species:Drosophila melanogaster


Alignment Length:55 Identity:15/55 - (27%)
Similarity:25/55 - (45%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASRIRREV--TMRPILVLSLVILATLVVLSSQATSTSPTSSSSTSPTSSSSTSP 53
            ||:|...|:  .|:...|:.::..||:.|:....|...|..|.:..|...:..||
  Fly    52 MANRAPFELKRVMQVYNVVQVLANATIFVIGLSNTYLQPGYSWTCQPVDHTDRSP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32071NP_729667.1 None
CG6660NP_651104.1 ELO 25..265 CDD:460083 15/55 (27%)

Return to query results.
Submit another query.