DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32071 and eloF

DIOPT Version :10

Sequence 1:NP_729667.1 Gene:CG32071 / 39246 FlyBaseID:FBgn0052071 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster


Alignment Length:37 Identity:4/37 - (10%)
Similarity:18/37 - (48%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASRIRREVTMRPILVLSLVILATLVVLSSQATSTSP 37
            ::..::|.:..:..:.::.::...:::|....|...|
  Fly   177 ISKEVQRSLWWKKYITIAQLVQFAIILLHCTITLAQP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32071NP_729667.1 None
eloFNP_649956.1 ELO 11..252 CDD:460083 4/37 (11%)

Return to query results.
Submit another query.