DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and Elovl4

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:257 Identity:118/257 - (45%)
Similarity:167/257 - (64%) Gaps:2/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSMGNDTKTESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVP 67
            |:..||| .|.|.:.:. :||:|..||||::|||..|::..||||.|...|||....:|.|:|:.
Mouse    16 STAFNDT-VEFYRWTWT-IADKRVADWPLMQSPWPTISISTLYLLFVWLGPKWMKDREPFQMRLV 78

  Fly    68 LFCHSLAMIFLNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTA 132
            |..::..|:.||.:|..|....|.:.||::.||....|:|.:|:|||.|:||:::||.:|::||.
Mouse    79 LIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAGALWWYFVSKGVEYLDTV 143

  Fly   133 FFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRV 197
            |||||.|.||:||||||||.|||...|..:||:..|..||.:.:|||:||||||||.|:..||.:
Mouse   144 FFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWI 208

  Fly   198 QRFLWWKRYLTGLQLVQFTIIFFWASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
            |::||||||||.||||||.:.....:..::..|.:.||:.....||.:.|:|:|..||.:.|
Mouse   209 QKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 97/212 (46%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 107/230 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849283
Domainoid 1 1.000 237 1.000 Domainoid score I2313
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I3157
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8727
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - LDO PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.