DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and ELOVL3

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:272 Identity:75/272 - (27%)
Similarity:119/272 - (43%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YPFADLADERTQDWPLVKSPWNIIALLAL-YLLMVRYAPKWTARCKPLQLRVPL----FCHSLAM 75
            |.|....|.|    |..:..|.....:|| ||:::.....:....|...|:.||    ||  ||:
Human    18 YNFELSKDMR----PFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFC--LAI 76

  Fly    76 IFLNGYICLEFLTASLSLGYNFACQECRVSH-DPHEIRIAAAMWWFYISKILEFVDTAFFILRHK 139
            ..:.|.:.:..:..::.|........|.::. |...::..:  |.|.:||::|..||||.|||.:
Human    77 FSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWS--WVFLLSKVIELGDTAFIILRKR 139

  Fly   140 WNQLSFLHVYHHSTMFLF-CWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWW 203
              .|.|:|.|||||:.:: .:.|...:|.|..|.  .:|..||.|||:||.|.....:..:.|  
Human   140 --PLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFV--TMNFGVHAIMYTYYTLKAANVKPPKML-- 198

  Fly   204 KRYLTGLQLVQF-------TIIFFWASQLVFRGC----EYGKWLTPIGAAYMVPFLFMFGRFYAQ 257
            ...:|.||::|.       .:.:.|...   :||    |:..|...:   ||..|: :|..|:.|
Human   199 PMLITSLQILQMFVGAIVSILTYIWRQD---QGCHTTMEHLFWSFIL---YMTYFI-LFAHFFCQ 256

  Fly   258 KYCVSAVVKKAK 269
            .|....|..|.|
Human   257 TYIRPKVKAKTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 63/235 (27%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 68/253 (27%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.