DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and HOS3-1

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:244 Identity:51/244 - (20%)
Similarity:85/244 - (34%) Gaps:82/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TQDWPLVKSPWN-IIALLALY------LLMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYIC 83
            :|.|   .|.|: :...::||      |.::..|.:.:.|..||. .:|.. |||.|..|:..|.
plant    27 SQSW---GSTWSFLFTSISLYIAVSSSLHILLSAVRRSNRSVPLG-HIPEI-HSLLMSILSATIF 86

  Fly    84 LEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMW---------------------------W-- 119
            ...|.::.:                 |||....:|                           |  
plant    87 AGILLSAAA-----------------EIRDTRWLWRRSKTATPLQWLLCFPLGTRPSGRVFFWSY 134

  Fly   120 -FYISKILEFVDTAFFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTF--FPSMINSFVH 181
             ||:::.|....|.|.:||.:  :|:...::.:|.|   .:|...||....::  ...:..:.|:
plant   135 VFYLTRFLHMFRTIFAVLRSR--RLAVSQLFCNSVM---AFTSFLWLEFSQSYQILAILSTTLVY 194

  Fly   182 VIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFTIIFFWASQLVFRGC 230
            .::|.|           || |....|.|.....|.:    ..|||..||
plant   195 SVVYGY-----------RF-WTGFGLPGSAFPSFVV----NCQLVLVGC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 44/215 (20%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.