DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and AT3G06460

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:249 Identity:77/249 - (30%)
Similarity:111/249 - (44%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIALLALYL---LMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLEFLTASLSLGYNFAC 99
            :..:::|||   .::||.........|..|:.....||| ::||            |||.....|
plant    36 VFVVVSLYLSATFLLRYTVDSLPTLGPRILKPITAVHSL-ILFL------------LSLTMAVGC 87

  Fly   100 QECRVSHDPHEIRIAAAM-------------WW---FYISKILEFVDTAFFILRHKWNQLSFLHV 148
            ....:|....:.|:..|:             :|   ||:|||||||||...||.....:||||||
plant    88 TLSLISSSDPKARLFDAVCFPLDVKPKGPLFFWAQVFYLSKILEFVDTLLIILNKSIQRLSFLHV 152

  Fly   149 YHHSTMFLFCWTYVKWLPTGSTFFP--SMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQ 211
            |||:|:.:.|:.   ||.|..:.||  .::||.||||||.||.|..:|.|.:    ||:.:|..|
plant   153 YHHATVVILCYL---WLRTRQSMFPVGLVLNSTVHVIMYGYYFLCAIGSRPK----WKKLVTNFQ 210

  Fly   212 LVQFTI------IFFWASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
            :|||..      .:.........||. |.|.......:....|.:|..|:::.|
plant   211 MVQFAFGMGLGAAWMLPEHYFGSGCA-GIWTVYFNGVFTASLLALFYNFHSKNY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 74/236 (31%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.