DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and ELOVL6

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:258 Identity:73/258 - (28%)
Similarity:108/258 - (41%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAM----IF----LNGYIC 83
            ::|   |..:...||.|.::...|:.....|:   .:||.||...||.:    ||    ...|:.
Human    28 ENW---KKSFLFSALYAAFIFGGRHLMNKRAK---FELRKPLVLWSLTLAVFSIFGALRTGAYMV 86

  Fly    84 LEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWW---FYISKILEFVDTAFFILRHKWNQLSF 145
            ...:|..|.   ...|.: ...:.|      .:.:|   |.:||..|..||.|.|||.:  :|.|
Human    87 YILMTKGLK---QSVCDQ-GFYNGP------VSKFWAYAFVLSKAPELGDTIFIILRKQ--KLIF 139

  Fly   146 LHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGL 210
            ||.|||.|:.|:.|...|.:..|..:|.:| |..||.:|||||||...|.||.|  .:..::|..
Human   140 LHWYHHITVLLYSWYSYKDMVAGGGWFMTM-NYGVHAVMYSYYALRAAGFRVSR--KFAMFITLS 201

  Fly   211 QLVQFT-------IIFFWAS--------QLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQK 258
            |:.|..       ::|.|..        |.:|       |.:.:..:|:|.|...|...|..|
Human   202 QITQMLMGCVVNYLVFCWMQHDQCHSHFQNIF-------WSSLMYLSYLVLFCHFFFEAYIGK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 68/237 (29%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.