DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and Elovl7

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:260 Identity:92/260 - (35%)
Similarity:140/260 - (53%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FADL--------------ADERTQDWPLVKSPWNIIALLALYLLMV-RYAPKWTARCKPLQLRVP 67
            |:||              ||.|.:|:.|:.||.....:|.||:..| ...||.....||.:|:..
Mouse     3 FSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKA 67

  Fly    68 LFCHSLAMIFLNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTA 132
            :..::..::..:.|:|.||:.:....||:|.|.....|..|..:|:....|.:|.||.:|.:||.
Mouse    68 MITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTI 132

  Fly   133 FFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRV 197
            ||:||.|.:|::||||:||:.|....|..||:...|...|.:.:|:.|||:|||||.|..:||..
Mouse   133 FFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAY 197

  Fly   198 QRFLWWKRYLTGLQLVQFTIIFFWASQLVF-RGC--EYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
            |::||||::||.||||||.::.....|:.| ..|  :|..:|..| .:|...||.:|..|:.:.|
Mouse   198 QKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYII-MSYGCIFLLLFLHFWYRAY 261

  Fly   260  259
            Mouse   262  261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 79/216 (37%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 85/233 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.