DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elovl2

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005162628.1 Gene:elovl2 / 678614 ZFINID:ZDB-GENE-060421-5612 Length:295 Species:Danio rerio


Alignment Length:256 Identity:92/256 - (35%)
Similarity:134/256 - (52%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLEFL 87
            |.|.:.|.|:.|......|...|||.:....|:........|:..|..::.::..|:.|:.:|.:
Zfish    23 DTRVRGWLLLDSYTPTFLLTITYLLTIYLGTKYMRNRPAYSLKNVLLLYNFSVTVLSFYMLVELI 87

  Fly    88 TASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYHHS 152
            :|..|.||...||......:. :||:|..:||:|.||::||:||.|.:||.|.:|:||||||||:
Zfish    88 SAVWSAGYRLQCQALDEVGEA-DIRVAKVLWWYYFSKLIEFLDTIFIVLRKKNSQISFLHVYHHA 151

  Fly   153 TMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFTI 217
            :||...|..:.|:|.|.:||...:|||:||:|||||.|:.: |.:.::||||||||..|||||.:
Zfish   152 SMFNIWWCVLNWIPCGQSFFGPTLNSFIHVLMYSYYGLATI-PSMHKYLWWKRYLTQAQLVQFVL 215

  Fly   218 IFFWASQLVFRGCEYGKWLTPIG---------AAYMVPFLFMFGRFYAQKYCVSAVVKKAK 269
            .....         ...|:.|.|         ..||...:.:|..||.|.|      ||.|
Zfish   216 TITHT---------VSAWVVPCGFPLGCLKFQTFYMCTLVVLFVNFYIQTY------KKRK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 80/227 (35%)
elovl2XP_005162628.1 ELO 31..262 CDD:279492 89/248 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.