DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and ELOVL4

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens


Alignment Length:259 Identity:116/259 - (44%)
Similarity:171/259 - (66%) Gaps:2/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSSMGNDTKTESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLR 65
            :.|:..||| .|.|.:.:: :||:|.::|||::|||..:::..||||.|...|||....:|.|:|
Human    14 VVSTALNDT-VEFYRWTWS-IADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMR 76

  Fly    66 VPLFCHSLAMIFLNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVD 130
            :.|..::..|:.||.:|..|....|.:.||::.||....|::.||:|||||:||:::||.:|::|
Human    77 LVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLD 141

  Fly   131 TAFFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGP 195
            |.|||||.|.||:||||||||.|||...|..:||:..|..||.:.:|||:||||||||.|:..||
Human   142 TVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGP 206

  Fly   196 RVQRFLWWKRYLTGLQLVQFTIIFFWASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
            .:|::||||||||.|||:||.:.....:..::..|.:.||:.....||.:.|:|:|..||.:.|
Human   207 WIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 97/212 (46%)
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 106/230 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158906
Domainoid 1 1.000 238 1.000 Domainoid score I2304
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I3179
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8493
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - LDO PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.