DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and ELOVL5

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:284 Identity:89/284 - (31%)
Similarity:139/284 - (48%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DTKTESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHS 72
            |....:|........|.|.:.|.|:.:.........:|||:|...||:....:|...|..|..::
Human     5 DASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYN 69

  Fly    73 LAMIFLNGYICLE---------------------------FLTASLSLGYNFACQECRVSHDPHE 110
            |.:..|:.|:..|                           .:|......|||.||..|.:.: .:
Human    70 LGLTLLSLYMFCESKREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGTRTAGE-SD 133

  Fly   111 IRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSM 175
            ::|...:||:|.||::||:||.|||||...:|::.||||||::|....|..:.|:|.|.::|.:.
Human   134 MKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGAT 198

  Fly   176 INSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFTIIFFWASQLVFRGCEYGKWLTPIG 240
            :|||:||:|||||.||.: |.::.:||||:|:|..||:||.:.....|..|...|.:     |:|
Human   199 LNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTF-----PLG 257

  Fly   241 -----AAYMVPFLFMFGRFYAQKY 259
                 ..||:..:.:|..||.|.|
Human   258 WLYFQIGYMISLIALFTNFYIQTY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 80/244 (33%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 84/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8493
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.