DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elovl1

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:247 Identity:93/247 - (37%)
Similarity:137/247 - (55%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ADERTQDWPLVKSPWNIIALLALYLLMV-RYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLE 85
            ||.|..|:||::||:...|:|..|:..| ...|:..|..||..|:..:..::.:::.|:.||..|
 Frog    19 ADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLMVVYNFSLVALSAYIVYE 83

  Fly    86 FLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYH 150
            ||.:....||.:.|....||..|..:|:....|.|..||.:|.:||.||::|.|.:|::|||::|
 Frog    84 FLMSGWLTGYTWRCDPVDVSDTPMALRMVRVAWLFLFSKFIELLDTVFFVVRKKNSQITFLHIFH 148

  Fly   151 HSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQF 215
            ||.:....|..||:.|.|...|.:||||.||||||.||.||..|||.|::||||:::|.:||:||
 Frog   149 HSVLPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAAGPRFQKYLWWKKHMTAIQLIQF 213

  Fly   216 TIIFFWASQLVF-RGCEYGK-------WLTPIGAAYMVPFLFMFGRFYAQKY 259
            .::....||..| ..|:|..       |:      |...|..:|..|:.|.|
 Frog   214 VLVSIHISQYYFMSSCDYQYPIFIHLIWI------YGTVFFILFSNFWYQAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 82/221 (37%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 89/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.