DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and Elovl2

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:242 Identity:95/242 - (39%)
Similarity:139/242 - (57%) Gaps:12/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLEFL 87
            |.|.:.|.|:.|......|..:|||.:....|:......|.||..|..::|.:..|:.|:.:|.:
  Rat    23 DSRVRGWFLLDSYLPTFTLTIVYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLVELV 87

  Fly    88 TASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYHHS 152
            .:|...|||..||... |....:||:|..:||:|.||::||:||.||:||.|.:|::|||||||:
  Rat    88 LSSWEGGYNLQCQNLD-SAGEGDIRVAKVLWWYYFSKLVEFLDTIFFVLRKKTSQITFLHVYHHA 151

  Fly   153 TMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFTI 217
            :||...|..:.|:|.|.:||...:|||:|::|||||.|||. |.:.|:||||:|||..|||||.:
  Rat   152 SMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHRYLWWKKYLTQAQLVQFVL 215

  Fly   218 IFFWASQLVFRGCEYGKWLTPIG-----AAYMVPFLFMFGRFYAQKY 259
            ........|.:.|.:     |.|     ::||:..:.:|..||.|.|
  Rat   216 TITHTLSAVVKPCGF-----PFGCLIFQSSYMMTLVILFLNFYIQTY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 86/217 (40%)
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 92/235 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8964
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.