DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elovl5

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:249 Identity:90/249 - (36%)
Similarity:135/249 - (54%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLEFL 87
            |.|.:.|.|:.:....|...||||.:|...||:.....|:..|..|..::|.:..|:.|:..|.:
 Frog    20 DPRVRGWLLLDNYVPTILFTALYLFIVWRGPKYMQNRPPVSCRGILVVYNLGLTLLSLYMFYELV 84

  Fly    88 TASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYHHS 152
            |.....||||.||:.....|. :.:|...:||:|.||::||:||.|||||...:|::.||||||:
 Frog    85 TGVWEGGYNFFCQDTNSGGDA-DTKIVRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHA 148

  Fly   153 TMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQF-- 215
            :|....|..:.|:|.|.::|.:.:|||:||:|||||.||.: |.::.:||||:|:|..||.||  
 Frog   149 SMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAI-PAMRPYLWWKKYITQCQLTQFVL 212

  Fly   216 -----TIIFFWASQ-----LVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
                 |....|..:     |.|:.|            ||:..:.:||.||.:.|
 Frog   213 TMTQTTCAMIWPCKFPMGWLYFQNC------------YMISLIILFGNFYIKTY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 81/224 (36%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 87/241 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.