DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and CG9459

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:83/259 - (32%)
Similarity:126/259 - (48%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PLVKSPWNIIALLALYLLMVRYAPKW-TARCKPLQLRVPLFCHSLAMIFLNGYICLEFLTASLSL 93
            ||..|.|.::.:|.:||:.::....| ....||..|...:..:::..|..|  :.|...:....|
  Fly    20 PLTSSHWPVLTILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNIVQIAYN--VILLIFSVHFML 82

  Fly    94 G---YNFACQECRVSHDP--HEIRIAAAMW--W----FYISKILEFVDTAFFILRHKWNQLSFLH 147
            |   |||:|    :|:.|  ||.:    .|  |    ::.:|:::.::|.|||.|.|:.|:||||
  Fly    83 GPGNYNFSC----ISNLPLDHEYK----NWERWLSYSYFFNKLMDLLETVFFIFRKKYRQISFLH 139

  Fly   148 VYHHSTM----FLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLT 208
            |:||..|    ||:.:.|..   .|..||....|..||.:||:||..|.|.......||||:|:|
  Fly   140 VFHHVYMVYIGFLYMYYYGY---GGHGFFLITFNVVVHTMMYTYYYQSSLNRNSGGDLWWKKYIT 201

  Fly   209 GLQLVQFTIIFFWASQLVF----RGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKYCVSAVVKKA 268
            .:|||||.|||   |..|:    ..|:..:.....|:...|.|:.:|..||.:.|.:....|.|
  Fly   202 VVQLVQFVIIF---SHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNFYVRTYILPKKTKSA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 74/238 (31%)
CG9459NP_649958.2 ELO 20..261 CDD:279492 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473115
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.