DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and CG8534

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster


Alignment Length:248 Identity:79/248 - (31%)
Similarity:130/248 - (52%) Gaps:15/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PLVKSPWNIIALLALYLLMV-RYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLEFLTASLSL 93
            ||:.|||..:.:::||||.| :...|:....||..||..:..:::..|..||.|.:..|.....|
  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVL 83

  Fly    94 -GYNFACQECRVSHDP--HEIRIAAAMWW---FYISKILEFVDTAFFILRHKWNQLSFLHVYHHS 152
             .|:..|    ::..|  ||:: :...|.   ::.:|.::.::|.||:||.|..|:|||||:||.
  Fly    84 KAYDLRC----ITKLPLDHELK-SRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143

  Fly   153 TMFLFCWTYVKWLPTGSTFFP-SMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFT 216
            .|....:.::.:...|.|.|| .::|..||||||:||.||.:...||... ||:|:|.:|||||.
  Fly   144 VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLVQFI 207

  Fly   217 IIFF-WASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKYCVSAVVKKA 268
            ::.. ::..|:...|...:.:...|......|:.||..||...|.::...:|:
  Fly   208 LVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 69/227 (30%)
CG8534NP_649955.1 ELO 19..259 CDD:366492 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473079
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.850

Return to query results.
Submit another query.