DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and CG31522

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster


Alignment Length:280 Identity:101/280 - (36%)
Similarity:152/280 - (54%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ADERTQDWPLVKSPWNIIALLALYLLMVR-YAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLE 85
            :|.||:.||::.||:..:|:...|:.:|: ..|:.....|||.|:..|..::...:..:.::..|
  Fly    19 SDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYE 83

  Fly    86 FL--------------------TASLSLG--------YNFACQECRVSHDPHEIRIAAAMWWFYI 122
            .|                    ..|..:|        |:|.||....|::|..:|:..|.||:|.
  Fly    84 CLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYF 148

  Fly   123 SKILEFVDTAFFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTG-STFFPSMINSFVHVIMYS 186
            ||..||:||.||:||.|.:|::.|||.||..|.:..|..||:.|.| |||| .::|:|||::||:
  Fly   149 SKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFF-GLLNTFVHIVMYT 212

  Fly   187 YYALSVLGPRVQRFLWWKRYLTGLQLVQFTIIFFWASQLVFRGCEYGK----WLTPIGAAYMVPF 247
            ||..|.:||:.|::||||:|||.||:|||.:|...|.||:|..|.|.|    |:    ..:.|.|
  Fly   213 YYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWI----GMHAVMF 273

  Fly   248 LFMFGRFYAQKYCVSAVVKK 267
            .|:|..||...| .|.::||
  Fly   274 FFLFNEFYKAAY-RSRMMKK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 90/252 (36%)
CG31522NP_001262254.1 ELO 27..293 CDD:279492 97/272 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473082
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1110.930

Return to query results.
Submit another query.