DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elovl5

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 / 393425 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio


Alignment Length:255 Identity:93/255 - (36%)
Similarity:137/255 - (53%) Gaps:12/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLA 74
            :..||...:....|.|...|.|:...........:|||:|...||:....:....|..|..::|.
Zfish     7 RVNSYIDSWMGPRDLRVTGWFLLDDYIPTFIFTVMYLLIVWMGPKYMKNRQAYSCRALLVPYNLC 71

  Fly    75 MIFLNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHK 139
            :..|:.|:..|.:.:....||||.||......|. :.|:...:||:|.||::||:||.|||||..
Zfish    72 LTLLSLYMFYELVMSVYQGGYNFFCQNTHSGGDA-DNRMMNVLWWYYFSKLIEFMDTFFFILRKN 135

  Fly   140 WNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWK 204
            .:|::|||||||:||....|..:.|:|.|.::|.:..|||:||:|||||.||.: |.::.:||||
Zfish   136 NHQITFLHVYHHATMLNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAV-PALRPYLWWK 199

  Fly   205 RYLTGLQLVQFTIIFFWASQLVFRGCEYGKWLTPIG-----AAYMVPFLFMFGRFYAQKY 259
            :|:|..|||||.:..|..|..|...|.:     |:|     .:|||..:.:|..||.|.|
Zfish   200 KYITQGQLVQFVLTMFQTSCAVVWPCGF-----PMGWLYFQISYMVTLILLFSNFYIQTY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 84/217 (39%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 88/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.