DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and CG18609

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:247 Identity:79/247 - (31%)
Similarity:121/247 - (48%) Gaps:29/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PLVKSPWNIIALLALYLLMVRYAPK-WTARCKPLQLRVPLFCHSLAMIFLNG-YICLEFLTASLS 92
            ||..|||.|..:|..|||.|....| :....||..|:..|..::|..:..|| |..:.|.     
  Fly    16 PLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFY----- 75

  Fly    93 LGYNFACQECRV--------SHDPHEI-RIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHV 148
              |.|....|.:        .|:..:: |:..|.  :.::|:|:.:||.||:||..:.|::|||:
  Fly    76 --YLFIVGICNLHCIESFPEGHERKQLERVLHAA--YLLNKVLDLMDTVFFVLRKSYKQITFLHI 136

  Fly   149 YHHSTMFLFCWTYVKWLPTGS-TFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQL 212
            |||..|....:...::..||. .....::||.||.:||.||.||...|.|:..:|||:|:|..||
  Fly   137 YHHVFMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITLTQL 201

  Fly   213 VQFTIIFFWASQLVFRGCEYGKWLTPIGAAYM-----VPFLFMFGRFYAQKY 259
            .||.::..:|..:.|.....|   .|.|..|:     |.|:::||:||...|
  Fly   202 CQFFMLLSYAIYVRFFSPNCG---VPRGLLYLNMVQGVVFIYLFGKFYIDNY 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 69/229 (30%)
CG18609NP_611365.2 ELO 16..257 CDD:279492 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473109
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1211.880

Return to query results.
Submit another query.