DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and CG31523

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:256 Identity:97/256 - (37%)
Similarity:141/256 - (55%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FADL----ADERTQDWPLVKSPWNIIALLALYLLMVR-YAPKWTARCKPLQLRVPLFCHSLAMIF 77
            :.||    :|.|..|:.|:.||...:.:...|....: ..|:..|:.||::||..|..::.....
  Fly    12 YRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTI 76

  Fly    78 LNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQ 142
            .:.:|..|:|.:.....|:..||....|.....:|:....||:||||..||.||.|||||.|...
  Fly    77 FSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEH 141

  Fly   143 LSFLHVYHHSTMFLFCWTYVKWLPTG-STFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRY 206
            :|.|||.||..|....|..:|:.|.| |||| :::|||||::||.||.::.:||:.|:::|||:|
  Fly   142 VSTLHVIHHGCMPFSVWMGLKFAPGGHSTFF-ALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKY 205

  Fly   207 LTGLQLVQFTIIFFWASQLVFRGCEYGK----WLTPIGAAYMVPFLFMFGRFYAQKYCVSA 263
            ||..|:|||..||....||:||.|:|.|    |:    ..:.|.|||:|..||..||..:|
  Fly   206 LTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVWI----GLHGVMFLFLFSDFYKAKYLNAA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 88/222 (40%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473124
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.800

Return to query results.
Submit another query.