DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:80/255 - (31%)
Similarity:120/255 - (47%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SPWN--IIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLEFLTASLSLGYN 96
            |.|:  |:::.|.|::::......|.| |||:.|.....|:..:..::|.: |..|...:...|.
pombe    53 SQWSSVIVSITAYYVIILSGRAIMTNR-KPLKQRRLFQLHNFILTIISGAL-LALLVEEVFRNYM 115

  Fly    97 ----FACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYHHSTMFLF 157
                |.| .|...|...  |:....:..|::|.||.:||.|..|:.|  .|:|||.|||....|.
pombe   116 RNGLFYC-VCDSRHFTQ--RLVTLYYLNYLTKYLELMDTVFLFLKKK--PLAFLHCYHHGITALL 175

  Fly   158 CWTY------VKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFT 216
            |:|.      |:|...|       :|.:|||||||||.|:..|.||    |||:::|.:|::||.
pombe   176 CFTQLLGRTSVQWGVIG-------LNLYVHVIMYSYYFLAACGRRV----WWKQWVTRVQIIQFV 229

  Fly   217 I-----IFFWASQLVFRGCEYGKWLTPIG-------AAY-----MVPFLFMFGRFYAQKY 259
            :     .|...|.:.||   |..||..:|       ||:     :..:||:|..||...|
pombe   230 LDLILCYFGTYSHIAFR---YFPWLPHVGDCSGSLFAAFFGCGVLSSYLFLFIGFYINTY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 75/239 (31%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.