DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elo-9

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_497086.1 Gene:elo-9 / 190207 WormBaseID:WBGene00001247 Length:286 Species:Caenorhabditis elegans


Alignment Length:291 Identity:79/291 - (27%)
Similarity:123/291 - (42%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GNDTKTESYSYPFADLADERTQDW-------PLVKSPW-NIIALLALYLLMVRYAPKWTARCKPL 62
            ||: :|..|| ||...:....:.|       ...|:.| ..:.|.|.|::......::....||.
 Worm    14 GNN-ETIIYS-PFEYDSTLLIESWWDDLTMHTFFKNHWFKSVYLSAAYIIATNLLQRYMESRKPK 76

  Fly    63 QLRVPLFCHSLAMIFLNGYIC-----------LEFLTASLSLGY-NFACQECRVSHDPHEIRIAA 115
            .:| ||      ::..||::.           :||..|....|: :..|    ::.:|   |..:
 Worm    77 SMR-PL------LLAWNGFLAVFSIMGTWRFGIEFYDAVFRRGFIDSIC----LAVNP---RSPS 127

  Fly   116 AMW--WFYISKILEFVDTAFFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINS 178
            |.|  .|.:|||.||.||.|.:||.:  .:.|||.|||:.:.:..|.....|.....:|..| |.
 Worm   128 AFWACMFALSKIAEFGDTMFLVLRKR--PVIFLHWYHHAVVLILSWHAAIELTAPGRWFIFM-NY 189

  Fly   179 FVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQFTI---IFFWASQLVFRG--CEYGKWLTP 238
            .||.|||:|||::.:|.|:.:.:  ...:|.||.:|..|   |......|...|  |:.......
 Worm   190 LVHSIMYTYYAITSIGYRLPKIV--SMTVTFLQTLQMLIGVSISCIVLYLKLNGEMCQQSYDNLA 252

  Fly   239 IGAAYMVPFLFMFGRFYAQKYCVSAVVKKAK 269
            :.......||.:|..|:...|    :|||.|
 Worm   253 LSFGIYASFLVLFSSFFNNAY----LVKKDK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 63/237 (27%)
elo-9NP_497086.1 ELO 44..274 CDD:279492 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.