DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elo-3

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001367447.1 Gene:elo-3 / 183948 WormBaseID:WBGene00001241 Length:320 Species:Caenorhabditis elegans


Alignment Length:274 Identity:82/274 - (29%)
Similarity:127/274 - (46%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ESYS--YPFADLADE-RTQDWPLVKSPW-NIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHS 72
            |:||  .||....|. |:..|  :::.| ..|....:|:.::....|...:.||.||..|||..:
 Worm    13 ENYSIFLPFETSFDAFRSTTW--MQNHWYQSITASVVYVAVIFTGKKIMEKYKPFQLDTPLFVWN 75

  Fly    73 --LAMIFLNGYICL--EFLTASLSLGYNFACQECRVSHDPHEIRIAAAMW--WFYISKILEFVDT 131
              ||:..:.|::.:  ||:.:..:.|.:|....|..|:    .:.....|  .|.:||:.|.:||
 Worm    76 SFLAIFSILGFLRMTPEFVWSWSAEGNSFKYSICHSSY----AQGVTGFWTEQFAMSKLFELIDT 136

  Fly   132 AFFILRHKWNQLSFLHVYHHSTMFLFCW-TYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGP 195
            .|.:||.:  .|.|||.|||.|:.::.| .|.....:|..|.  .:|..||.:|||||||..|..
 Worm   137 IFIVLRKR--PLIFLHWYHHVTVMIYTWHAYKDHTASGRWFI--WMNYGVHALMYSYYALRSLKF 197

  Fly   196 RVQRFLWWKRYLTGLQLVQF---TIIFFWASQLVFRGCEYGK--WLTPIGAAYMVPFLF--MFGR 253
            |:.:.:  ...:|.|||.|.   .||.....::...| ||.:  | ..:|..:.|.|.:  :|..
 Worm   198 RLPKQM--AMVVTTLQLAQMVMGVIIGVTVYRIKSSG-EYCQQTW-DNLGLCFGVYFTYFLLFAN 258

  Fly   254 FYAQKYCVSAVVKK 267
            |:...|     |||
 Worm   259 FFYHAY-----VKK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 69/232 (30%)
elo-3NP_001367447.1 ELO 33..270 CDD:395916 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.