DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elo-6

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_500797.1 Gene:elo-6 / 177321 WormBaseID:WBGene00001244 Length:274 Species:Caenorhabditis elegans


Alignment Length:268 Identity:70/268 - (26%)
Similarity:97/268 - (36%) Gaps:90/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YLLMVRYAPKWTARC---------------KPLQLRVPL-----------FCHSLAMIF--LNGY 81
            ::...:||..|.:..               ||..|..||           ...|||..|  |:.:
 Worm    25 HIAQTQYAAFWISMAYVVVIFGLKAVMTNRKPFDLTGPLNLWNAGLAIFSTLGSLATTFGLLHEF 89

  Fly    82 ICLEFLTASLSLG--YN-----FACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHK 139
            ....|..:.:.:|  ||     |.                   |.|.:||:.||.||.|.|||.|
 Worm    90 FSRGFFESYIHIGDFYNGLSGMFT-------------------WLFVLSKVAEFGDTLFIILRKK 135

  Fly   140 WNQLSFLHVYHHSTMFLFCW----------TYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLG 194
              .|.|||.|||.....:.:          |::.|:           |..||.|||.||.|...|
 Worm   136 --PLMFLHWYHHVLTMNYAFMSFEANLGFNTWITWM-----------NFSVHSIMYGYYMLRSFG 187

  Fly   195 PRVQRFLWWKRYLTGLQLVQFTI---IFFWASQLVFRGCEYGKWLTPIGAAYM-----VPFLFMF 251
            .:|.  .|..:.:|.:|::||.|   |.|....|...|.....  || |..:.     :.::.:|
 Worm   188 VKVP--AWIAKNITTMQILQFVITHFILFHVGYLAVTGQSVDS--TP-GYYWFCLLMEISYVVLF 247

  Fly   252 GRFYAQKY 259
            |.||.|.|
 Worm   248 GNFYYQSY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 70/265 (26%)
elo-6NP_500797.1 ELO 33..262 CDD:279492 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.