DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elo-5

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001368393.1 Gene:elo-5 / 177320 WormBaseID:WBGene00001243 Length:274 Species:Caenorhabditis elegans


Alignment Length:166 Identity:45/166 - (27%)
Similarity:70/166 - (42%) Gaps:43/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 WWFY---ISKILEFVDTAFFILRHKWNQLSFLHVYHHST---MFLFCW-------TYVKWLPTGS 169
            :|.:   ||||.|.:||.|.:||.:  .|.|:|.|||:.   ..|.|:       .:|.|:    
 Worm   105 YWIFLWVISKIPELLDTVFIVLRKR--PLIFMHWYHHALTGYYALVCYHEDAVHMVWVVWM---- 163

  Fly   170 TFFPSMINSFVHVIMYSYYALSVL----GPRVQRFLWWKRYLTGLQLVQFTIIFFWASQLVFR-- 228
                   |..:|..||.||.|..|    .|.|      .:.:|..|:|||.:..|....:.::  
 Worm   164 -------NYIIHAFMYGYYLLKSLKVPIPPSV------AQAITTSQMVQFAVAIFAQVHVSYKHY 215

  Fly   229 -----GCEYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
                 |..|....|.||...:..:.:::.:||.:.|
 Worm   216 VEGVEGLAYSFRGTAIGFFMLTTYFYLWIQFYKEHY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 45/166 (27%)
elo-5NP_001368393.1 ELO 29..258 CDD:395916 45/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.