DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and Elovl5

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:257 Identity:92/257 - (35%)
Similarity:139/257 - (54%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DTKTESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHS 72
            |....:|........|.|.:.|.|:.:........|:|||:|...||:....:|...|..|..::
  Rat     5 DASLSTYFRALLGPRDTRVKGWFLLDNYIPTFVCSAIYLLIVWLGPKYMKNRQPFSCRGILVVYN 69

  Fly    73 LAMIFLNGYICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILR 137
            |.:..|:.|:..|.:|......|||.||..| |....::::...:||:|.||::||:||.|||||
  Rat    70 LGLTLLSLYMFYELVTGVWEGKYNFFCQGTR-SAGESDMKVIRVLWWYYFSKLIEFMDTFFFILR 133

  Fly   138 HKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLW 202
            ...:|::.||||||:||....|..:.|:|.|.::|.:.:|||:||:|||||.||.: |.::.:||
  Rat   134 KNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLW 197

  Fly   203 WKRYLTGLQLVQFTIIFFWASQLVFRGCEYGKWLTPIG-----AAYMVPFLFMFGRFYAQKY 259
            ||:|:|..|||||.:.....|..|...|.:     |:|     ..||:..:.:|..||.|.|
  Rat   198 WKKYITQGQLVQFVLTIIQTSCGVIWPCSF-----PLGWLYFQIGYMISLIALFTNFYIQTY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 82/217 (38%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 87/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8964
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.