DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and Elovl6

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_569717.1 Gene:Elovl6 / 170439 MGIID:2156528 Length:267 Species:Mus musculus


Alignment Length:270 Identity:77/270 - (28%)
Similarity:112/270 - (41%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAM----IF----LNGYIC 83
            ::|   |..:...||.|.::...|:.....|:   .:||.||...||.:    ||    ...|:.
Mouse    28 ENW---KKSFLFSALYAAFIFGGRHLMNKRAK---FELRKPLVLWSLTLAVFSIFGALRTGAYML 86

  Fly    84 LEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWW---FYISKILEFVDTAFFILRHKWNQLSF 145
            ...:|..|.   ...|.: ...:.|      .:.:|   |.:||..|..||.|.|||.:  :|.|
Mouse    87 YILMTKGLK---QSVCDQ-SFYNGP------VSKFWAYAFVLSKAPELGDTIFIILRKQ--KLIF 139

  Fly   146 LHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGL 210
            ||.|||.|:.|:.|...|.:..|..:|.:| |..||.:|||||||...|.||.|  .:..::|..
Mouse   140 LHWYHHITVLLYSWYSYKDMVAGGGWFMTM-NYGVHAVMYSYYALRAAGFRVSR--KFAMFITLS 201

  Fly   211 QLVQFT-------IIFFWAS----------QLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQK 258
            |:.|..       ::|.|..          |.:|       |.:.:..:|:|.|...|...|..|
Mouse   202 QITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIF-------WSSLMYLSYLVLFCHFFFEAYIGK 259

  Fly   259 YCVSAVVKKA 268
                  ||||
Mouse   260 ------VKKA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 69/246 (28%)
Elovl6NP_569717.1 ELO 25..264 CDD:395916 77/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.