DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68beta and elovl3

DIOPT Version :9

Sequence 1:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_002935809.1 Gene:elovl3 / 100497108 XenbaseID:XB-GENE-977704 Length:270 Species:Xenopus tropicalis


Alignment Length:236 Identity:61/236 - (25%)
Similarity:100/236 - (42%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LYLLMVRYAPKWTARCKPLQLRVP--LFCHSLAMIFLNGYICLEFLTASLSLGYNFACQECRVSH 106
            ||..::....:.....:..:||.|  |:..:||:..:.|.:...:...::.:...|....|    
 Frog    45 LYAALIFGGQRMMKERRRFELRRPLVLWSFTLAVFSIIGAVRTGWFMGNILITNGFKQSVC---- 105

  Fly   107 DPHEIRIAAAMWW---FYISKILEFVDTAFFILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTG 168
            |........:.:|   |.:||:.|..||.|.:||.:  :|.|||.|||.|:.|:.|...|....|
 Frog   106 DRAFYSGPVSKFWAYAFVLSKVPELGDTLFIVLRKQ--KLIFLHWYHHITVLLYTWYTYKDTVAG 168

  Fly   169 STFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQF-------TIIFFW----- 221
            ..:|.:| |..||..|||||.|...|.||.|..  ..::|..|::|.       .:::.|     
 Frog   169 GGWFMTM-NYTVHAFMYSYYTLRAAGIRVPRPC--AMFITFTQILQMVMGIVVNALVYSWRQDGS 230

  Fly   222 ---ASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKY 259
               .::.:|       |...:..:|.:.|...|.:.|. ||
 Frog   231 CLSTTENIF-------WSCLMYFSYFILFCSFFYKAYL-KY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 59/232 (25%)
elovl3XP_002935809.1 ELO 31..262 CDD:366492 59/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.