DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and UBA3

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_003959.3 Gene:UBA3 / 9039 HGNCID:12470 Length:463 Species:Homo sapiens


Alignment Length:407 Identity:84/407 - (20%)
Similarity:148/407 - (36%) Gaps:69/407 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDLGNNFFLDSSYLGKSKALAC 94
            |.||:...|.::....:|||..|.|.|.|.....|.|..|:...:|...|......:|:.||...
Human    64 QFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVA 128

  Fly    95 MQLLQELNPDVN-GDYVDESADFLLANRPNFFDSF-------DLVIASN-LNEQTLLLLAERLWE 150
            .:.|.:..|:.| ..:.::..||    ...|:..|       |.:||.. :|...:.||......
Human   129 AEFLNDRVPNCNVVPHFNKIQDF----NDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGV 189

  Fly   151 LN----VPLIYCRSLGMLGTIRLQIRE-----HCIVEAHPDNRQFDLRLEHPFDALREHLDGTEV 206
            |:    ||||...:.|..|..|:.:..     .|.:|.:|....|.:........|.||.     
Human   190 LDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHC----- 249

  Fly   207 TSKVPWLLVLHKYLNVWQKQQADGTQTPRNYKEKNQLKETIREEM-KADEENYEEAIKAVNTAFG 270
               :.::.:|.     |.|:|..|...|.:..:...::...::.: :|.:.|    |:.|.....
Human   250 ---IEYVRMLQ-----WPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYN----IRGVTYRLT 302

  Fly   271 AGQVPKSLKAIFEDDACEQLNKKSNVFWIMAKA---LKHFVIH-------------ENEGHLPLP 319
            .|.|.:.:.|:...:|.......:.||.|...|   |.::::.             |.:.:.|..
Human   303 QGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPAC 367

  Fly   320 GVLP---DMTANTDSYIALQHIYRQQALQDADQVYHKCQE------YLKQLALPADSIDERSVRL 375
            ..||   ..:.:......|.::....:||..........|      ||:.:.    ||:||:...
Human   368 SQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVT----SIEERTRPN 428

  Fly   376 ICKEAAGLAVIRGTRIA 392
            :.|....|.::.|..:|
Human   429 LSKTLKELGLVDGQELA 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 84/407 (21%)
ThiF 17..>171 CDD:223552 40/153 (26%)
UBA3NP_003959.3 Interaction with UBE2M N-terminus 53..70 3/5 (60%)
Uba3_RUB 71..368 CDD:238765 65/317 (21%)
Interaction with UBE2M N-terminus 157..161 1/3 (33%)
Interaction with UBE2M N-terminus 192..217 7/24 (29%)
Interaction with NEDD8 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 242..248 1/5 (20%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 292..295 1/6 (17%)
Interaction with UBE2M N-terminus 331..338 2/6 (33%)
Interaction with NEDD8 352..357 0/4 (0%)
Interaction with UBE2M core domain 368..463 16/82 (20%)
E2_bind 376..461 CDD:400951 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.