DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and ATG7

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_012041.1 Gene:ATG7 / 856576 SGDID:S000001214 Length:630 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:67/327 - (20%)
Similarity:104/327 - (31%) Gaps:127/327 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 APKSPELS---DKSKKYDRQI---------RLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLP 57
            ||:..:||   |..|..|:.:         |:..:....:::...|.|:....:||..::.|:..
Yeast   282 APRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAW 346

  Fly    58 GIGGFTVADGSTVKEEDLGNNFFLDSSYLGKSKALACMQLLQELNP--DVNG----------DYV 110
            |:...|..|..||...:.......:....||.||......|:.:.|  |..|          ..|
Yeast   347 GVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLV 411

  Fly   111 DESA---DF---------------------------LLANRPN--------FFDSFDLVIASNLN 137
            :|.|   ||                           ||:|..|        .|||:.::...|.:
Yeast   412 NEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRD 476

  Fly   138 EQT----------------------------------LLLLAERL-WELNVPLIYCRSLG----M 163
            ||:                                  :.::|..| .||...|:..:..|    :
Yeast   477 EQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTV 541

  Fly   164 LGTIRLQIR----------------EHC------IVEAHPD-NRQFDLR-LEHPFDALREHLDGT 204
            ||.|..|||                |||      ::||..| ..:|..: ||||.  ..|.:.|.
Yeast   542 LGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPL--YLEEISGL 604

  Fly   205 EV 206
            .|
Yeast   605 SV 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 62/313 (20%)
ThiF 17..>171 CDD:223552 44/251 (18%)
ATG7NP_012041.1 E1_like_apg7 9..628 CDD:273590 67/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.