DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and TCD2

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_012898.1 Gene:TCD2 / 853841 SGDID:S000001510 Length:447 Species:Saccharomyces cerevisiae


Alignment Length:399 Identity:68/399 - (17%)
Similarity:120/399 - (30%) Gaps:139/399 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SDKSKKYDRQ---------IRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADG 67
            :||..:||.|         :...||.....|....|.:|....||......||..|.....|.| 
Yeast    54 TDKYHQYDEQFIRQSLKNNVEFLGEDTIEKLSNQYVVVVGAGGVGSWVVNSLVRSGCRKIRVVD- 117

  Fly    68 STVKEEDLGNNFFLDSSYLGKSKALACMQLLQELNPDVNGDYVDESADFLLANRPNFFDSFDLVI 132
                                                                        ||.|.
Yeast   118 ------------------------------------------------------------FDQVS 122

  Fly   133 ASNLNEQTLLLLAERLWELNVPLIYCRSLGMLGTIRLQIRE---HCIVEAHPDNRQFDLRLEHPF 194
            .|:||..:..:|.    ::..|.:.|        :|..:||   .|  |..|.|..:.|:.....
Yeast   123 LSSLNRHSCAILN----DVGTPKVEC--------LRRHMREIAPWC--EIDPINELWTLQNGERL 173

  Fly   195 -------DALREHLDGTEVTSKVPWLLVLHKY-LNVWQKQQADGTQTPRNYK-------EKNQLK 244
                   |.:.:.:|  .:.:||..|...:.: :.|.....|.....|....       |::.|.
Yeast   174 TLGNGTPDFIVDCID--NIDTKVDLLEFAYNHGIKVISSMGASAKSDPTKLNVGDLATTEEDPLA 236

  Fly   245 ETIREEMKADEENYEEAIKAVNTAFGAGQV-PKSLKAI------FEDDACEQLNKKSNVFWIMAK 302
            ..:|.::|.     ...:..:...|.|.:. ||..|.:      :|....::|:           
Yeast   237 RVVRRKLKK-----RGILSGIPVVFSAEKPDPKKAKLLPLPDEEYERGKVDELS----------- 285

  Fly   303 ALKHFVIHENEGHLPLPGVLPDMTANT-DSYI-------ALQHIYRQQALQDADQVYHKCQEYLK 359
            |||.|.:.    .||:.|.:|.:...| .::|       .|:.:..:..::..|.:|......:.
Yeast   286 ALKDFRVR----ILPVLGTMPSLFGLTITTWILSNISDKPLEPVEGKNRIKVYDGIYQSLAGQMS 346

  Fly   360 QLALPADSI 368
            ::.:|:..|
Yeast   347 RVGIPSQRI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 66/395 (17%)
ThiF 17..>171 CDD:223552 25/162 (15%)
TCD2NP_012898.1 TcdA 63..325 CDD:224100 60/358 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.