DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and AT3G25880

DIOPT Version :10

Sequence 1:NP_648435.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001326600.1 Gene:AT3G25880 / 822183 AraportID:AT3G25880 Length:74 Species:Arabidopsis thaliana


Alignment Length:69 Identity:25/69 - (36%)
Similarity:38/69 - (55%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSDKSKKYDRQIRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDL 75
            :.:...|||||: ::...|  .||.|::||:|...:|....|.|||.|:|..|:.:||.|...|:
plant     1 MMEPKAKYDRQL-MYTIQG--TLEEASICLLNCGPIGSNALKNLVLGGVGSITIVEGSKVLIGDI 62

  Fly    76 GNNF 79
            ...|
plant    63 WKQF 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_648435.1 APPBP1_RUB 16..522 CDD:238770 25/64 (39%)
AT3G25880NP_001326600.1 E1_enzyme_family 6..>62 CDD:451392 23/58 (40%)

Return to query results.
Submit another query.